C1RL,C1r-LP,C1RL1
  • C1RL,C1r-LP,C1RL1

Anti-C1RL Antibody 100ul

Ref: AN-HPA011338-100ul
Anti-C1RL

Información del producto

Polyclonal Antibody against Human C1RL, Gene description: complement component 1, r subcomponent-like, Alternative Gene Names: C1r-LP, C1RL1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NZP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1RL
Gene Description complement component 1, r subcomponent-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Immunogen NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1r-LP, C1RL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZP8
HTS Code 3002150000
Gene ID 51279
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C1RL Antibody 100ul

Anti-C1RL Antibody 100ul