ATP2B1,PMCA1
  • ATP2B1,PMCA1

Anti-ATP2B1 Antibody 100ul

Ref: AN-HPA011166-100ul
Anti-ATP2B1

Información del producto

Polyclonal Antibody against Human ATP2B1, Gene description: ATPase, Ca++ transporting, plasma membrane 1, Alternative Gene Names: PMCA1, Validated applications: ICC, IHC, WB, Uniprot ID: P20020, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ATP2B1
Gene Description ATPase, Ca++ transporting, plasma membrane 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGI
Immunogen DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PMCA1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P20020
HTS Code 3002150000
Gene ID 490
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ATP2B1 Antibody 100ul

Anti-ATP2B1 Antibody 100ul