LAT,LAT1
  • LAT,LAT1

Anti-LAT Antibody 100ul

Ref: AN-HPA011157-100ul
Anti-LAT

Información del producto

Polyclonal Antibody against Human LAT, Gene description: linker for activation of T cells, Alternative Gene Names: LAT1, Validated applications: ICC, IHC, WB, Uniprot ID: O43561, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LAT
Gene Description linker for activation of T cells
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG
Immunogen HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LAT1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43561
HTS Code 3002150000
Gene ID 27040
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LAT Antibody 100ul

Anti-LAT Antibody 100ul