SFTPC,BRICD6,PSP-C
  • SFTPC,BRICD6,PSP-C

Anti-SFTPC Antibody 25ul

Ref: AN-HPA010928-25ul
Anti-SFTPC

Información del producto

Polyclonal Antibody against Human SFTPC, Gene description: surfactant protein C, Alternative Gene Names: BRICD6, PSP-C, SFTP2, SMDP2, SP-C, Validated applications: IHC, WB, Uniprot ID: P11686, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SFTPC
Gene Description surfactant protein C
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
Immunogen PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRICD6, PSP-C, SFTP2, SMDP2, SP-C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11686
HTS Code 3002150000
Gene ID 6440
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SFTPC Antibody 25ul

Anti-SFTPC Antibody 25ul