FXYD3,MAT-8,PLML
  • FXYD3,MAT-8,PLML

Anti-FXYD3 Antibody 100ul

Ref: AN-HPA010856-100ul
Anti-FXYD3

Información del producto

Polyclonal Antibody against Human FXYD3, Gene description: FXYD domain containing ion transport regulator 3, Alternative Gene Names: MAT-8, PLML, Validated applications: IHC, Uniprot ID: Q14802, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FXYD3
Gene Description FXYD domain containing ion transport regulator 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
Immunogen MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MAT-8, PLML
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q14802
HTS Code 3002150000
Gene ID 5349
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FXYD3 Antibody 100ul

Anti-FXYD3 Antibody 100ul