SPATA9,FLJ35906
  • SPATA9,FLJ35906

Anti-SPATA9 Antibody 25ul

Ref: AN-HPA010848-25ul
Anti-SPATA9

Información del producto

Polyclonal Antibody against Human SPATA9, Gene description: spermatogenesis associated 9, Alternative Gene Names: FLJ35906, NYD-SP16, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BWV2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPATA9
Gene Description spermatogenesis associated 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI
Immunogen LKKVKNIFQEEESIRQNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVLHSVFDQSAEMNEQI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ35906, NYD-SP16
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BWV2
HTS Code 3002150000
Gene ID 83890
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPATA9 Antibody 25ul

Anti-SPATA9 Antibody 25ul