IGSF9B,KIAA1030
  • IGSF9B,KIAA1030

Anti-IGSF9B Antibody 100ul

Ref: AN-HPA010802-100ul
Anti-IGSF9B

Información del producto

Polyclonal Antibody against Human IGSF9B, Gene description: immunoglobulin superfamily, member 9B, Alternative Gene Names: KIAA1030, Validated applications: IHC, Uniprot ID: Q9UPX0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IGSF9B
Gene Description immunoglobulin superfamily, member 9B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LEAPLSSGKVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQLTPLSSSQE
Immunogen LEAPLSSGKVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAEAEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPLVPTSVAALKSQLTPLSSSQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1030
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPX0
HTS Code 3002150000
Gene ID 22997
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IGSF9B Antibody 100ul

Anti-IGSF9B Antibody 100ul