C1orf43
  • C1orf43

Anti-C1orf43 Antibody 100ul

Ref: AN-HPA010725-100ul
Anti-C1orf43

Información del producto

Polyclonal Antibody against Human C1orf43, Gene description: chromosome 1 open reading frame 43, Alternative Gene Names: DKFZp586G1722, NICE-3, Validated applications: IHC, Uniprot ID: Q9BWL3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1orf43
Gene Description chromosome 1 open reading frame 43
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS
Immunogen AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp586G1722, NICE-3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BWL3
HTS Code 3002150000
Gene ID 25912
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C1orf43 Antibody 100ul

Anti-C1orf43 Antibody 100ul