LMTK2,AATYK2,BREK
  • LMTK2,AATYK2,BREK

Anti-LMTK2 Antibody 100ul

Ref: AN-HPA010657-100ul
Anti-LMTK2

Información del producto

Polyclonal Antibody against Human LMTK2, Gene description: lemur tyrosine kinase 2, Alternative Gene Names: AATYK2, BREK, cprk, KIAA1079, KPI-2, KPI2, LMR2, PPP1R100, Validated applications: ICC, IHC, Uniprot ID: Q8IWU2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LMTK2
Gene Description lemur tyrosine kinase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MELNGVQADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTELQFAENKPGLSLLQENV
Immunogen MELNGVQADFKPATLSSSLDNPKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELKNAGFTEAMLETSCRNSLDTELQFAENKPGLSLLQENV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AATYK2, BREK, cprk, KIAA1079, KPI-2, KPI2, LMR2, PPP1R100
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWU2
HTS Code 3002150000
Gene ID 22853
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LMTK2 Antibody 100ul

Anti-LMTK2 Antibody 100ul