CYB5R1,humb5R2
  • CYB5R1,humb5R2

Anti-CYB5R1 Antibody 100ul

Ref: AN-HPA010641-100ul
Anti-CYB5R1

Información del producto

Polyclonal Antibody against Human CYB5R1, Gene description: cytochrome b5 reductase 1, Alternative Gene Names: humb5R2, NQO3A2, Validated applications: IHC, Uniprot ID: Q9UHQ9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CYB5R1
Gene Description cytochrome b5 reductase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEP
Immunogen TLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names humb5R2, NQO3A2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UHQ9
HTS Code 3002150000
Gene ID 51706
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYB5R1 Antibody 100ul

Anti-CYB5R1 Antibody 100ul