HSPA4,HS24/P52,HSPH2
  • HSPA4,HS24/P52,HSPH2

Anti-HSPA4 Antibody 25ul

Ref: AN-HPA010023-25ul
Anti-HSPA4

Información del producto

Polyclonal Antibody against Human HSPA4, Gene description: heat shock 70kDa protein 4, Alternative Gene Names: HS24/P52, HSPH2, Validated applications: ICC, IHC, WB, Uniprot ID: P34932, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HSPA4
Gene Description heat shock 70kDa protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDG
Immunogen FEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HS24/P52, HSPH2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P34932
HTS Code 3002150000
Gene ID 3308
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSPA4 Antibody 25ul

Anti-HSPA4 Antibody 25ul