LAMA3,BM600-150kDa
  • LAMA3,BM600-150kDa

Anti-LAMA3 Antibody 100ul

Ref: AN-HPA009309-100ul
Anti-LAMA3

Información del producto

Polyclonal Antibody against Human LAMA3, Gene description: laminin, alpha 3, Alternative Gene Names: BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa, Validated applications: ICC, IHC, Uniprot ID: Q16787, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LAMA3
Gene Description laminin, alpha 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
Immunogen LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16787
HTS Code 3002150000
Gene ID 3909
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LAMA3 Antibody 100ul

Anti-LAMA3 Antibody 100ul