CD276,B7-H3,B7H3
  • CD276,B7-H3,B7H3

Anti-CD276 Antibody 100ul

Ref: AN-HPA009285-100ul
Anti-CD276

Información del producto

Polyclonal Antibody against Human CD276, Gene description: CD276 molecule, Alternative Gene Names: B7-H3, B7H3, B7RP-2, Validated applications: IHC, WB, Uniprot ID: Q5ZPR3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CD276
Gene Description CD276 molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Immunogen YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B7-H3, B7H3, B7RP-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5ZPR3
HTS Code 3002150000
Gene ID 80381
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CD276 Antibody 100ul

Anti-CD276 Antibody 100ul