SHOC2,KIAA0862
  • SHOC2,KIAA0862

Anti-SHOC2 Antibody 25ul

Ref: AN-HPA009164-25ul
Anti-SHOC2

Información del producto

Polyclonal Antibody against Human SHOC2, Gene description: soc-2 suppressor of clear homolog (C. elegans), Alternative Gene Names: KIAA0862, SOC-2, SOC2, SUR-8, SUR8, Validated applications: ICC, WB, Uniprot ID: Q9UQ13, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SHOC2
Gene Description soc-2 suppressor of clear homolog (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, ICC
Sequence LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
Immunogen LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0862, SOC-2, SOC2, SUR-8, SUR8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UQ13
HTS Code 3002150000
Gene ID 8036
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SHOC2 Antibody 25ul

Anti-SHOC2 Antibody 25ul