PNPLA7,C9orf111
  • PNPLA7,C9orf111

Anti-PNPLA7 Antibody 25ul

Ref: AN-HPA009130-25ul
Anti-PNPLA7

Información del producto

Polyclonal Antibody against Human PNPLA7, Gene description: patatin-like phospholipase domain containing 7, Alternative Gene Names: C9orf111, FLJ31318, FLJ43070, FLJ44279, NTE-R1, NTEL1, RP11-48C7.2, Validated applications: IHC, Uniprot ID: Q6ZV29, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PNPLA7
Gene Description patatin-like phospholipase domain containing 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESSLRHRHPSLAFPKLSE
Immunogen CEVGYQHGRTVFDIWGRSGVLEKMLRDQQGPSKKPASAVLTCPNASFTDLAEIVSRIEPAKPAMVDDESDYQTEYEEELLDVPRDAYADFQSTSAQQGSDLEDESSLRHRHPSLAFPKLSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C9orf111, FLJ31318, FLJ43070, FLJ44279, NTE-R1, NTEL1, RP11-48C7.2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZV29
HTS Code 3002150000
Gene ID 375775
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PNPLA7 Antibody 25ul

Anti-PNPLA7 Antibody 25ul