CFAP61,C20orf26
  • CFAP61,C20orf26

Anti-CFAP61 Antibody 100ul

Ref: AN-HPA009079-100ul
Anti-CFAP61

Información del producto

Polyclonal Antibody against Human CFAP61, Gene description: cilia and flagella associated protein 61, Alternative Gene Names: C20orf26, CaM-IP3, dJ1002M8.3, DKFZP434K156, Validated applications: IHC, Uniprot ID: Q8NHU2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CFAP61
Gene Description cilia and flagella associated protein 61
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE
Immunogen HMKFNNLTLISTHGLPGKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTDEIVPYDHLILCTGQQYQVPCPTEADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALIWIRNNSITTE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf26, CaM-IP3, dJ1002M8.3, DKFZP434K156
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NHU2
HTS Code 3002150000
Gene ID 26074
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CFAP61 Antibody 100ul

Anti-CFAP61 Antibody 100ul