EFNB2,EPLG5,Htk-L
  • EFNB2,EPLG5,Htk-L

Anti-EFNB2 Antibody 25ul

Ref: AN-HPA008999-25ul
Anti-EFNB2

Información del producto

Polyclonal Antibody against Human EFNB2, Gene description: ephrin-B2, Alternative Gene Names: EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228, Validated applications: ICC, IHC, WB, Uniprot ID: P52799, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EFNB2
Gene Description ephrin-B2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Immunogen YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52799
HTS Code 3002150000
Gene ID 1948
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EFNB2 Antibody 25ul

Anti-EFNB2 Antibody 25ul