SLC27A6,ACSVL2
  • SLC27A6,ACSVL2

Anti-SLC27A6 Antibody 100ul

Ref: AN-HPA008987-100ul
Anti-SLC27A6

Información del producto

Polyclonal Antibody against Human SLC27A6, Gene description: solute carrier family 27 (fatty acid transporter), member 6, Alternative Gene Names: ACSVL2, FACVL2, FATP6, VLCS-H1, Validated applications: ICC, IHC, Uniprot ID: Q9Y2P4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC27A6
Gene Description solute carrier family 27 (fatty acid transporter), member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWS
Immunogen LGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACSVL2, FACVL2, FATP6, VLCS-H1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2P4
HTS Code 3002150000
Gene ID 28965
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC27A6 Antibody 100ul

Anti-SLC27A6 Antibody 100ul