TMED7,CGI-109
  • TMED7,CGI-109

Anti-TMED7 Antibody 100ul

Ref: AN-HPA008960-100ul
Anti-TMED7

Información del producto

Polyclonal Antibody against Human TMED7, Gene description: transmembrane emp24 protein transport domain containing 7, Alternative Gene Names: CGI-109, FLJ90481, Validated applications: IHC, WB, Uniprot ID: Q9Y3B3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TMED7
Gene Description transmembrane emp24 protein transport domain containing 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
Immunogen ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-109, FLJ90481
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3B3
HTS Code 3002150000
Gene ID 51014
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TMED7 Antibody 100ul

Anti-TMED7 Antibody 100ul