NUAK2,FLJ90349,SNARK
  • NUAK2,FLJ90349,SNARK

Anti-NUAK2 Antibody 100ul

Ref: AN-HPA008958-100ul
Anti-NUAK2

Información del producto

Polyclonal Antibody against Human NUAK2, Gene description: NUAK family, SNF1-like kinase, 2, Alternative Gene Names: FLJ90349, SNARK, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H093, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NUAK2
Gene Description NUAK family, SNF1-like kinase, 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Immunogen DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90349, SNARK
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H093
HTS Code 3002150000
Gene ID 81788
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NUAK2 Antibody 100ul

Anti-NUAK2 Antibody 100ul