HEXIM1,CLP-1,EDG1
  • HEXIM1,CLP-1,EDG1

Anti-HEXIM1 Antibody 100ul

Ref: AN-HPA008926-100ul
Anti-HEXIM1

Información del producto

Polyclonal Antibody against Human HEXIM1, Gene description: hexamethylene bis-acetamide inducible 1, Alternative Gene Names: CLP-1, EDG1, HIS1, MAQ1, Validated applications: ICC, IHC, WB, Uniprot ID: O94992, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HEXIM1
Gene Description hexamethylene bis-acetamide inducible 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence AKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERA
Immunogen AKSDDTSDDDFMEEGGEEDGGSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSRMEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLP-1, EDG1, HIS1, MAQ1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94992
HTS Code 3002150000
Gene ID 10614
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HEXIM1 Antibody 100ul

Anti-HEXIM1 Antibody 100ul