ANKHD1,FLJ10042
  • ANKHD1,FLJ10042

Anti-ANKHD1 Antibody 25ul

Ref: AN-HPA008718-25ul
Anti-ANKHD1

Información del producto

Polyclonal Antibody against Human ANKHD1, Gene description: ankyrin repeat and KH domain containing 1, Alternative Gene Names: FLJ10042, FLJ11979, FLJ14127, FLJ20288, KIAA1085, MASK, Validated applications: IHC, Uniprot ID: Q8IWZ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ANKHD1
Gene Description ankyrin repeat and KH domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD
Immunogen QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10042, FLJ11979, FLJ14127, FLJ20288, KIAA1085, MASK
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IWZ3
HTS Code 3002150000
Gene ID 54882
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ANKHD1 Antibody 25ul

Anti-ANKHD1 Antibody 25ul