SLC6A15,FLJ10316
  • SLC6A15,FLJ10316

Anti-SLC6A15 Antibody 25ul

Ref: AN-HPA008609-25ul
Anti-SLC6A15

Información del producto

Polyclonal Antibody against Human SLC6A15, Gene description: solute carrier family 6 (neutral amino acid transporter), member 15, Alternative Gene Names: FLJ10316, hv7-3, NTT73, SBAT1, V7-3, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H2J7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC6A15
Gene Description solute carrier family 6 (neutral amino acid transporter), member 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
Immunogen RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10316, hv7-3, NTT73, SBAT1, V7-3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2J7
HTS Code 3002150000
Gene ID 55117
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC6A15 Antibody 25ul

Anti-SLC6A15 Antibody 25ul