NME1,NDPKA,NM23
  • NME1,NDPKA,NM23

Anti-NME1 Antibody 100ul

Ref: AN-HPA008467-100ul
Anti-NME1

Información del producto

Polyclonal Antibody against Human NME1, Gene description: NME/NM23 nucleoside diphosphate kinase 1, Alternative Gene Names: NDPKA, NM23, NM23-H1, Validated applications: ICC, IHC, WB, Uniprot ID: P15531, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NME1
Gene Description NME/NM23 nucleoside diphosphate kinase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Immunogen MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NDPKA, NM23, NM23-H1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P15531
HTS Code 3002150000
Gene ID 4830
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NME1 Antibody 100ul

Anti-NME1 Antibody 100ul