EPS15,AF-1P,MLLT5
  • EPS15,AF-1P,MLLT5

Anti-EPS15 Antibody 25ul

Ref: AN-HPA008451-25ul
Anti-EPS15

Información del producto

Polyclonal Antibody against Human EPS15, Gene description: epidermal growth factor receptor pathway substrate 15, Alternative Gene Names: AF-1P, MLLT5, Validated applications: ICC, IHC, WB, Uniprot ID: P42566, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EPS15
Gene Description epidermal growth factor receptor pathway substrate 15
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Immunogen CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AF-1P, MLLT5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P42566
HTS Code 3002150000
Gene ID 2060
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EPS15 Antibody 25ul

Anti-EPS15 Antibody 25ul