CCT7,Ccth,Nip7-1
  • CCT7,Ccth,Nip7-1

Anti-CCT7 Antibody 25ul

Ref: AN-HPA008425-25ul
Anti-CCT7

Información del producto

Polyclonal Antibody against Human CCT7, Gene description: chaperonin containing TCP1, subunit 7 (eta), Alternative Gene Names: Ccth, Nip7-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q99832, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCT7
Gene Description chaperonin containing TCP1, subunit 7 (eta)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE
Immunogen ELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNFFTGCPKAKTCTFILRGGAEQFMEETE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Ccth, Nip7-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99832
HTS Code 3002150000
Gene ID 10574
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCT7 Antibody 25ul

Anti-CCT7 Antibody 25ul