NFKB2,LYT-10,NF-kB2
  • NFKB2,LYT-10,NF-kB2

Anti-NFKB2 Antibody 25ul

Ref: AN-HPA008422-25ul
Anti-NFKB2

Información del producto

Polyclonal Antibody against Human NFKB2, Gene description: nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100), Alternative Gene Names: LYT-10, NF-kB2, p105, p52, Validated applications: ICC, IHC, WB, Uniprot ID: Q00653, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NFKB2
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Immunogen LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LYT-10, NF-kB2, p105, p52
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q00653
HTS Code 3002150000
Gene ID 4791
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NFKB2 Antibody 25ul

Anti-NFKB2 Antibody 25ul