CKAP2,FLJ10749,LB1
  • CKAP2,FLJ10749,LB1

Anti-CKAP2 Antibody 25ul

Ref: AN-HPA008410-25ul
Anti-CKAP2

Información del producto

Polyclonal Antibody against Human CKAP2, Gene description: cytoskeleton associated protein 2, Alternative Gene Names: FLJ10749, LB1, se20-10, TMAP, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WWK9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CKAP2
Gene Description cytoskeleton associated protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGR
Immunogen PPIRSHHSNTRDTVKQGISRTSANVTIRKGPHEKELLQSKTALSSVKTSSSQGIIRNKTLSRSIASEVVARPASLSNDKLMEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10749, LB1, se20-10, TMAP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWK9
HTS Code 3002150000
Gene ID 26586
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CKAP2 Antibody 25ul

Anti-CKAP2 Antibody 25ul