PPBP,b-TG1,Beta-TG
  • PPBP,b-TG1,Beta-TG

Anti-PPBP Antibody 25ul

Ref: AN-HPA008354-25ul
Anti-PPBP

Información del producto

Polyclonal Antibody against Human PPBP, Gene description: pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), Alternative Gene Names: b-TG1, Beta-TG, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, NAP-2-L1, PBP, SCYB7, TGB, TGB1, THBGB1, Validated applications: IHC, WB, Uniprot ID: P02775, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PPBP
Gene Description pro-platelet basic protein (chemokine (C-X-C motif) ligand 7)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Immunogen GQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names b-TG1, Beta-TG, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, NAP-2-L1, PBP, SCYB7, TGB, TGB1, THBGB1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P02775
HTS Code 3002150000
Gene ID 5473
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPBP Antibody 25ul

Anti-PPBP Antibody 25ul