ARPC2,ARC34,p34-Arc
  • ARPC2,ARC34,p34-Arc

Anti-ARPC2 Antibody 100ul

Ref: AN-HPA008352-100ul
Anti-ARPC2

Información del producto

Polyclonal Antibody against Human ARPC2, Gene description: actin related protein 2/3 complex, subunit 2, 34kDa, Alternative Gene Names: ARC34, p34-Arc, Validated applications: IHC, WB, Uniprot ID: O15144, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ARPC2
Gene Description actin related protein 2/3 complex, subunit 2, 34kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Immunogen TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARC34, p34-Arc
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15144
HTS Code 3002150000
Gene ID 10109
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARPC2 Antibody 100ul

Anti-ARPC2 Antibody 100ul