RPN2,RIBIIR,RPN-II
  • RPN2,RIBIIR,RPN-II

Anti-RPN2 Antibody 100ul

Ref: AN-HPA008297-100ul
Anti-RPN2

Información del producto

Polyclonal Antibody against Human RPN2, Gene description: ribophorin II, Alternative Gene Names: RIBIIR, RPN-II, RPNII, SWP1, Validated applications: IHC, Uniprot ID: P04844, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPN2
Gene Description ribophorin II
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE
Immunogen SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RIBIIR, RPN-II, RPNII, SWP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P04844
HTS Code 3002150000
Gene ID 6185
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPN2 Antibody 100ul

Anti-RPN2 Antibody 100ul