STK40,MGC4796,SgK495
  • STK40,MGC4796,SgK495

Anti-STK40 Antibody 100ul

Ref: AN-HPA008026-100ul
Anti-STK40

Información del producto

Polyclonal Antibody against Human STK40, Gene description: serine/threonine kinase 40, Alternative Gene Names: MGC4796, SgK495, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N2I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STK40
Gene Description serine/threonine kinase 40
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence AKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTDDFYQLKILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLVLDCLCAHDFSDKTADL
Immunogen AKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTDDFYQLKILTLEERGDQGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLVLDCLCAHDFSDKTADL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC4796, SgK495
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N2I9
HTS Code 3002150000
Gene ID 83931
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STK40 Antibody 100ul

Anti-STK40 Antibody 100ul