RPS6KA1,HU-1,RSK
  • RPS6KA1,HU-1,RSK

Anti-RPS6KA1 Antibody 100ul

Ref: AN-HPA007981-100ul
Anti-RPS6KA1

Información del producto

Polyclonal Antibody against Human RPS6KA1, Gene description: ribosomal protein S6 kinase, 90kDa, polypeptide 1, Alternative Gene Names: HU-1, RSK, RSK1, Validated applications: ICC, IHC, WB, Uniprot ID: Q15418, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPS6KA1
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC, ICC
Sequence KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
Immunogen KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HU-1, RSK, RSK1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15418
HTS Code 3002150000
Gene ID 6195
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RPS6KA1 Antibody 100ul

Anti-RPS6KA1 Antibody 100ul