VSIR,B7-H5,B7H5
  • VSIR,B7-H5,B7H5

Anti-VSIR Antibody 25ul

Ref: AN-HPA007968-25ul
Anti-VSIR

Información del producto

Polyclonal Antibody against Human VSIR, Gene description: V-set immunoregulatory receptor, Alternative Gene Names: B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA, Validated applications: IHC, WB, Uniprot ID: Q9H7M9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VSIR
Gene Description V-set immunoregulatory receptor
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Immunogen LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B7-H5, B7H5, C10orf54, GI24, PD-1H, SISP1, VISTA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H7M9
HTS Code 3002150000
Gene ID 64115
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VSIR Antibody 25ul

Anti-VSIR Antibody 25ul