CYB5B,CYB5-M
  • CYB5B,CYB5-M

Anti-CYB5B Antibody 25ul

Ref: AN-HPA007893-25ul
Anti-CYB5B

Información del producto

Polyclonal Antibody against Human CYB5B, Gene description: cytochrome b5 type B (outer mitochondrial membrane), Alternative Gene Names: CYB5-M, Validated applications: ICC, IHC, WB, Uniprot ID: O43169, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CYB5B
Gene Description cytochrome b5 type B (outer mitochondrial membrane)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
Immunogen EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CYB5-M
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43169
HTS Code 3002150000
Gene ID 80777
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CYB5B Antibody 25ul

Anti-CYB5B Antibody 25ul