VPS9D1,ATP-BL
  • VPS9D1,ATP-BL

Anti-VPS9D1 Antibody 100ul

Ref: AN-HPA007847-100ul
Anti-VPS9D1

Información del producto

Polyclonal Antibody against Human VPS9D1, Gene description: VPS9 domain containing 1, Alternative Gene Names: ATP-BL, C16orf7, Validated applications: IHC, Uniprot ID: Q9Y2B5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VPS9D1
Gene Description VPS9 domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EAYTEYLRSIHYISQVLLEEVETTKEAGETVPPDTSKMLKLAQQCLERAQSTAAKLGKTRLKPTMPAAAPIPQPAGRHRRVYSDEGGKLSPFLPPEIFQKLQGAESQSCKK
Immunogen EAYTEYLRSIHYISQVLLEEVETTKEAGETVPPDTSKMLKLAQQCLERAQSTAAKLGKTRLKPTMPAAAPIPQPAGRHRRVYSDEGGKLSPFLPPEIFQKLQGAESQSCKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATP-BL, C16orf7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2B5
HTS Code 3002150000
Gene ID 9605
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VPS9D1 Antibody 100ul

Anti-VPS9D1 Antibody 100ul