MGRN1,KIAA0544
  • MGRN1,KIAA0544

Anti-MGRN1 Antibody 25ul

Ref: AN-HPA007653-25ul
Anti-MGRN1

Información del producto

Polyclonal Antibody against Human MGRN1, Gene description: mahogunin ring finger 1, E3 ubiquitin protein ligase, Alternative Gene Names: KIAA0544, RNF156, Validated applications: IHC, Uniprot ID: O60291, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MGRN1
Gene Description mahogunin ring finger 1, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDE
Immunogen LPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0544, RNF156
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60291
HTS Code 3002150000
Gene ID 23295
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MGRN1 Antibody 25ul

Anti-MGRN1 Antibody 25ul