B4GALT2,beta4Gal-T2
  • B4GALT2,beta4Gal-T2

Anti-B4GALT2 Antibody 100ul

Ref: AN-HPA007620-100ul
Anti-B4GALT2

Información del producto

Polyclonal Antibody against Human B4GALT2, Gene description: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2, Alternative Gene Names: beta4Gal-T2, Validated applications: ICC, Uniprot ID: O60909, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name B4GALT2
Gene Description UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
Immunogen PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names beta4Gal-T2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60909
HTS Code 3002150000
Gene ID 8704
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-B4GALT2 Antibody 100ul

Anti-B4GALT2 Antibody 100ul