P4HA1,C-P4Halpha(I)
  • P4HA1,C-P4Halpha(I)

Anti-P4HA1 Antibody 100ul

Ref: AN-HPA007599-100ul
Anti-P4HA1

Información del producto

Polyclonal Antibody against Human P4HA1, Gene description: prolyl 4-hydroxylase, alpha polypeptide I, Alternative Gene Names: C-P4Halpha(I), P4HA, Validated applications: ICC, IHC, WB, Uniprot ID: P13674, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name P4HA1
Gene Description prolyl 4-hydroxylase, alpha polypeptide I
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC
Immunogen FTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTDTISKGNLPGVKHKSFLTAEDC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C-P4Halpha(I), P4HA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13674
HTS Code 3002150000
Gene ID 5033
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-P4HA1 Antibody 100ul

Anti-P4HA1 Antibody 100ul