TSPAN13,NET-6
  • TSPAN13,NET-6

Anti-TSPAN13 Antibody 100ul

Ref: AN-HPA007426-100ul
Anti-TSPAN13

Información del producto

Polyclonal Antibody against Human TSPAN13, Gene description: tetraspanin 13, Alternative Gene Names: NET-6, TM4SF13, Validated applications: ICC, IHC, Uniprot ID: O95857, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSPAN13
Gene Description tetraspanin 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV
Immunogen ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NET-6, TM4SF13
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95857
HTS Code 3002150000
Gene ID 27075
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSPAN13 Antibody 100ul

Anti-TSPAN13 Antibody 100ul