MS4A8,CD20L5,MS4A4
  • MS4A8,CD20L5,MS4A4

Anti-MS4A8 Antibody 25ul

Ref: AN-HPA007318-25ul
Anti-MS4A8

Información del producto

Polyclonal Antibody against Human MS4A8, Gene description: membrane-spanning 4-domains, subfamily A, member 8, Alternative Gene Names: CD20L5, MS4A4, MS4A8B, Validated applications: IHC, WB, Uniprot ID: Q9BY19, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MS4A8
Gene Description membrane-spanning 4-domains, subfamily A, member 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
Immunogen MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD20L5, MS4A4, MS4A8B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BY19
HTS Code 3002150000
Gene ID 83661
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MS4A8 Antibody 25ul

Anti-MS4A8 Antibody 25ul