ZBED9,Buster4
  • ZBED9,Buster4

Anti-ZBED9 Antibody 100ul

Ref: AN-HPA007246-100ul
Anti-ZBED9

Información del producto

Polyclonal Antibody against Human ZBED9, Gene description: zinc finger, BED-type containing 9, Alternative Gene Names: Buster4, FLJ31087, KIAA1925, SCAND3, ZFP38-L, ZNF305P2, ZNF452, Validated applications: ICC, IHC, Uniprot ID: Q6R2W3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZBED9
Gene Description zinc finger, BED-type containing 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SAFSSEAKLGLSHSQLTEELVASLHTENELDQADKELENTLRAQYEENIETGTDSSDIEENLSVTPKVAEKSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGTEGCGRQITCSLCYETSTMK
Immunogen SAFSSEAKLGLSHSQLTEELVASLHTENELDQADKELENTLRAQYEENIETGTDSSDIEENLSVTPKVAEKSPPESRLRFLSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGTEGCGRQITCSLCYETSTMK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Buster4, FLJ31087, KIAA1925, SCAND3, ZFP38-L, ZNF305P2, ZNF452
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6R2W3
HTS Code 3002150000
Gene ID 114821
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZBED9 Antibody 100ul

Anti-ZBED9 Antibody 100ul