SULT1C2,ST1C1
  • SULT1C2,ST1C1

Anti-SULT1C2 Antibody 100ul

Ref: AN-HPA007190-100ul
Anti-SULT1C2

Información del producto

Polyclonal Antibody against Human SULT1C2, Gene description: sulfotransferase family, cytosolic, 1C, member 2, Alternative Gene Names: ST1C1, SULT1C1, Validated applications: IHC, WB, Uniprot ID: O00338, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SULT1C2
Gene Description sulfotransferase family, cytosolic, 1C, member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence PATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNH
Immunogen PATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ST1C1, SULT1C1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00338
HTS Code 3002150000
Gene ID 6819
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SULT1C2 Antibody 100ul

Anti-SULT1C2 Antibody 100ul