TSHZ1,NY-CO-33
  • TSHZ1,NY-CO-33

Anti-TSHZ1 Antibody 100ul

Ref: AN-HPA006982-100ul
Anti-TSHZ1

Información del producto

Polyclonal Antibody against Human TSHZ1, Gene description: teashirt zinc finger homeobox 1, Alternative Gene Names: NY-CO-33, SDCCAG33, TSH1, Validated applications: ICC, IHC, WB, Uniprot ID: Q6ZSZ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSHZ1
Gene Description teashirt zinc finger homeobox 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence YGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPS
Immunogen YGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NY-CO-33, SDCCAG33, TSH1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZSZ6
HTS Code 3002150000
Gene ID 10194
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSHZ1 Antibody 100ul

Anti-TSHZ1 Antibody 100ul