ZNF135,pHZ-17,ZNF61
  • ZNF135,pHZ-17,ZNF61

Anti-ZNF135 Antibody 25ul

Ref: AN-HPA006961-25ul
Anti-ZNF135

Información del producto

Polyclonal Antibody against Human ZNF135, Gene description: zinc finger protein 135, Alternative Gene Names: pHZ-17, ZNF61, ZNF78L1, Validated applications: ICC, IHC, WB, Uniprot ID: P52742, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF135
Gene Description zinc finger protein 135
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence FLWDGLWYCRGEDTEGHWEWSCESLESLAVPVAFTPVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQSPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECGKAFSHSSALI
Immunogen FLWDGLWYCRGEDTEGHWEWSCESLESLAVPVAFTPVKTPVLEQWQRNGFGENISLNPDLPHQPMTPERQSPHTWGTRGKREKPDLNVLQKTCVKEKPYKCQECGKAFSHSSALI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names pHZ-17, ZNF61, ZNF78L1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P52742
HTS Code 3002150000
Gene ID 7694
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF135 Antibody 25ul

Anti-ZNF135 Antibody 25ul