USP31,KIAA1203
  • USP31,KIAA1203

Anti-USP31 Antibody 100ul

Ref: AN-HPA006937-100ul
Anti-USP31

Información del producto

Polyclonal Antibody against Human USP31, Gene description: ubiquitin specific peptidase 31, Alternative Gene Names: KIAA1203, Validated applications: ICC, IHC, Uniprot ID: Q70CQ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name USP31
Gene Description ubiquitin specific peptidase 31
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLRNLSSSYQEPSD
Immunogen LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLRNLSSSYQEPSD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1203
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q70CQ4
HTS Code 3002150000
Gene ID 57478
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-USP31 Antibody 100ul

Anti-USP31 Antibody 100ul