SWAP70,KIAA0640
  • SWAP70,KIAA0640

Anti-SWAP70 Antibody 100ul

Ref: AN-HPA006810-100ul
Anti-SWAP70

Información del producto

Polyclonal Antibody against Human SWAP70, Gene description: SWAP switching B-cell complex 70kDa subunit, Alternative Gene Names: KIAA0640, SWAP-70, Validated applications: IHC, WB, Uniprot ID: Q9UH65, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SWAP70
Gene Description SWAP switching B-cell complex 70kDa subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR
Immunogen KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0640, SWAP-70
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UH65
HTS Code 3002150000
Gene ID 23075
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SWAP70 Antibody 100ul

Anti-SWAP70 Antibody 100ul