EIF4G2,DAP5,NAT1,p97
  • EIF4G2,DAP5,NAT1,p97

Anti-EIF4G2 Antibody 25ul

Ref: AN-HPA006773-25ul
Anti-EIF4G2

Información del producto

Polyclonal Antibody against Human EIF4G2, Gene description: eukaryotic translation initiation factor 4 gamma, 2, Alternative Gene Names: DAP5, NAT1, p97, Validated applications: ICC, IHC, WB, Uniprot ID: P78344, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF4G2
Gene Description eukaryotic translation initiation factor 4 gamma, 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, WB, IHC
Sequence QDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYH
Immunogen QDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DAP5, NAT1, p97
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P78344
HTS Code 3002150000
Gene ID 1982
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF4G2 Antibody 25ul

Anti-EIF4G2 Antibody 25ul