XRCC1,RCC
  • XRCC1,RCC

Anti-XRCC1 Antibody 100ul

Ref: AN-HPA006717-100ul
Anti-XRCC1

Información del producto

Polyclonal Antibody against Human XRCC1, Gene description: X-ray repair complementing defective repair in Chinese hamster cells 1, Alternative Gene Names: RCC, Validated applications: ICC, IHC, WB, Uniprot ID: P18887, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name XRCC1
Gene Description X-ray repair complementing defective repair in Chinese hamster cells 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
Immunogen WDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RCC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P18887
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-XRCC1 Antibody 100ul

Anti-XRCC1 Antibody 100ul