EPB41L2,4.1-G
  • EPB41L2,4.1-G

Anti-EPB41L2 Antibody 25ul

Ref: AN-HPA006642-25ul
Anti-EPB41L2

Información del producto

Polyclonal Antibody against Human EPB41L2, Gene description: erythrocyte membrane protein band 4.1-like 2, Alternative Gene Names: 4.1-G, Validated applications: ICC, IHC, Uniprot ID: O43491, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EPB41L2
Gene Description erythrocyte membrane protein band 4.1-like 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGA
Immunogen ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4.1-G
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43491
HTS Code 3002150000
Gene ID 2037
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EPB41L2 Antibody 25ul

Anti-EPB41L2 Antibody 25ul